2 for 1 sale You pick the included one Any vial, any size. NO CODE, NO LIMITS.

Need help? Call Or Text us, and a team member will be happy to assist you. +1 (855) 322-2214

Glow (GHKcu 2mg/BPC 500mcg/TB 500mcg) · 1002mg

Total Price $747.02
Discounted Price $575.20
Bottles 5 bottles
You Save
$171.82 23% OFF
Only $115.04 per bottle Final price per bottle after savings
On Sale!
Glow (GHKcu 2mg/BPC 500mcg/TB 500mcg) (10 btls.) – Licensed Peptides
Glow (GHKcu 2mg/BPC 500mcg/TB 500mcg) – lab report
Glow (GHKcu 2mg/BPC 500mcg/TB 500mcg) (10 btls.) – image 2
Glow (GHKcu 2mg/BPC 500mcg/TB 500mcg) (10 btls.) – image 3
Glow (GHKcu 2mg/BPC 500mcg/TB 500mcg) (10 btls.) – image 4
Glow (GHKcu 2mg/BPC 500mcg/TB 500mcg) (10 btls.) – Licensed Peptides
Glow (GHKcu 2mg/BPC 500mcg/TB 500mcg) – lab report
Glow (GHKcu 2mg/BPC 500mcg/TB 500mcg) (10 btls.) – image 2
Glow (GHKcu 2mg/BPC 500mcg/TB 500mcg) (10 btls.) – image 3
Glow (GHKcu 2mg/BPC 500mcg/TB 500mcg) (10 btls.) – image 4
⚠ Encapsulated Research Formulations
Retail Price $597.54
Your Price $597.54 Per vial: $42.58
You Save $597.54 33% OFF
Select Strength (mg)
99% HPLC Purity
Select Bottles
Bulk pricing applied
📈 Upgrade to 10 bottles and save an extra vs. buying 5 — nearly 3 bottles included.
Your included bottle Included · 2 for 1
Glow (GHKcu 2mg/BPC 500mcg/TB 500mcg)
Same as above
Included
  • 99%+ HPLC Purity — Independently verified by accredited US laboratory
  • Endotoxin-Screened — LAL tested, LPS-free, endotoxin report available
  • GMP-Certified Manufacturing — USA facility, ISO 9001:2015
  • Lyophilized for Stability — Shipped cold-packed, intact for reconstitution
Molecular Weight
Third Party Tested
APPLICATION
For Research Use only
Form
Lyophilized Powder
Storage
-20°C Long Term
Purity (HPLC)
99%+ Third Party Verified
Manufacture
USA / GMP

Glow (GHKcu 2mg/BPC 500mcg/TB 500mcg) · 1002mg

Total Price $747.02
Discounted Price $575.20
Bottles 5 bottles
You Save
$171.82 23% OFF
Only $115.04 per bottle Final price per bottle after savings
⚠ Encapsulated Research Formulations
Select Strength (mg)
99% HPLC Purity
Select Bottles
Bulk pricing applied
📈 Upgrade to 10 bottles and save an extra vs. buying 5 — nearly 3 bottles included.
Your included bottle Included · 2 for 1
Glow (GHKcu 2mg/BPC 500mcg/TB 500mcg)
Same as above
Included
  • 99%+ HPLC Purity — Independently verified by accredited US laboratory
  • Endotoxin-Screened — LAL tested, LPS-free, endotoxin report available
  • GMP-Certified Manufacturing — USA facility, ISO 9001:2015
  • Lyophilized for Stability — Shipped cold-packed, intact for reconstitution
Molecular Weight
Third Party Tested
APPLICATION
For Research Use only
Form
Lyophilized Powder
Storage
-20°C Long Term
Purity (HPLC)
99%+ Third Party Verified
Manufacture
USA / GMP
Reagent documentation

Scientific description

Structure, physicochemical data, analytical verification and safety documentation for the 3 components of this product (GHK-Cu, BPC-157, TB-500). Supplied for in-vitro laboratory research only.

Reagent overview

Reagent
Glow (GHKcu 2mg/BPC 500mcg/TB 500mcg)
Composition
Per unit: 2 mg GHK-Cu + 500 mcg BPC-157 + 500 mcg TB-500
60 units per bottle
Form
Encapsulated research formulation, 60 units per bottle
Content, current lot
2.09/0.53/0.51 mg per unitSpecification 2/0.5/0.5 mg per unit
CAS, GHK-Cu
89030-95-5
CAS, BPC-157
137525-51-0
CAS, TB-500
77591-33-4
Lot on file
26053002-GW5Released 03/26/2026
Testing laboratory
Ethos Analytics
Download COA (PDF) Lot record in the Testing Library

Molecular structure

Two-dimensional structures generated with RDKit and drawn in the site palette. Tap a drawing to enlarge it. Below each drawing, the residue chain in one-letter code with the three-letter name and position; colours mark the side-chain class, a dashed outline marks a D-residue or a non-proteinogenic residue (lower-case letters are D-residues).

Acidic (Asp, Glu)Basic (Lys, Arg, His)Polar uncharged (Ser, Thr, Asn, Gln, Cys, Tyr)Hydrophobic (Ala, Val, Leu, Ile, Met, Phe, Trp)Gly / ProD- or non-proteinogenic residue

GHK-Cu Copper(II) complex of glycyl-L-histidyl-L-lysine

2D structure drawing of GHK-CuTap to enlarge

2D depiction, C14H23CuN6O4, generated from the PubChem connection table, CID 71587328.

HGGly1HHis2KLys3OHCu(II)

H-Gly-His-Lys-OH

BPC-157 Pentadecapeptide BPC-157

2D structure drawing of BPC-157Tap to enlarge

2D depiction, C62H98N16O22, generated from the PubChem connection table, CID 9941957.

HGGly1EGlu2PPro3PPro4PPro5GGly6KLys7PPro8AAla9DAsp10DAsp11AAla12GGly13LLeu14VVal15OH

H-Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val-OH

TB-500 (thymosin beta-4) N-acetyl thymosin beta-4, 43 residues

2D structure drawing of TB-500Tap to enlarge

2D depiction, C212H350N56O78S, generated from the PubChem connection table, CID 45382195.

AcSSer1DAsp2KLys3PPro4DAsp5MMet6AAla7EGlu8IIle9EGlu10KLys11FPhe12DAsp13KLys14SSer15KLys16LLeu17KLys18KLys19TThr20EGlu21TThr22QGln23EGlu24KLys25NAsn26PPro27LLeu28PPro29SSer30KLys31EGlu32TThr33IIle34EGlu35QGln36EGlu37KLys38QGln39AAla40GGly41EGlu42SSer43OH

Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH (terminal groups: N-terminal acetyl, C-terminal acid)

Physicochemical data

Formula, masses and identifiers from PubChem where a record exists, checked against an independent RDKit calculation and, for peptides, against the residue sequence. Theoretical pI, net charge at pH 7.4, GRAVY and the 280 nm extinction coefficient are calculated with Biopython ProtParam on the residue chain (Bjellqvist pK set; Kyte-Doolittle; Gill and von Hippel) and are marked "calculated"; they are not given where the chain contains non-proteinogenic residues.

GHK-Cu

Molecular formula
C14H23CuN6O4 (salt / complex as in the PubChem record)
Average molecular weight
402.92 g/mol
Monoisotopic mass
402.108 Da
CAS number
89030-95-5
Sequence length
3 residues
PubChem CID
71587328
InChIKey
NZWIFMYRRCMYMN-ACMTZBLWSA-M
Peptide class
Copper(II) complex of the tripeptide Gly-His-Lys (1:1)
Solubility
Soluble in water (supplier specification); quantitative solubility not determined
Storage and handling
Store in the original sealed bottle, dry and protected from light, at the temperature stated on the label.
Shelf life
Refer to the lot Certificate of Analysis; re-test date assigned per lot

BPC-157

Molecular formula
C62H98N16O22
Average molecular weight
1419.5 g/mol
Monoisotopic mass
1418.704 Da
CAS number
137525-51-0
Sequence length
15 residues
Theoretical pI (calculated)
4.05
Net charge at pH 7.4 (calculated)
-2.4
GRAVY hydropathy (calculated)
-0.693
Extinction coefficient, 280 nm (calculated)
0 M-1 cm-1 (no Trp, Tyr or Cys)
PubChem CID
9941957
InChIKey
HEEWEZGQMLZMFE-RKGINYAYSA-N
Peptide class
Synthetic linear pentadecapeptide; partial sequence of a protein isolated from human gastric juice
Solubility
Soluble in water (supplier specification); quantitative solubility not determined
Storage and handling
Store in the original sealed bottle, dry and protected from light, at the temperature stated on the label.
Shelf life
Refer to the lot Certificate of Analysis; re-test date assigned per lot

TB-500 (thymosin beta-4)

Molecular formula
C212H350N56O78S
Average molecular weight
4963.5 g/mol
Monoisotopic mass
4960.486 Da
CAS number
77591-33-4
Sequence length
43 residues, N-terminal acetyl
Theoretical pI (calculated)
5.02 (free-terminus model)
Net charge at pH 7.4 (calculated)
-2.8
GRAVY hydropathy (calculated)
-1.702
Extinction coefficient, 280 nm (calculated)
0 M-1 cm-1 (no Trp, Tyr or Cys)
PubChem CID
45382195
InChIKey
UGPMCIBIHRSCBV-UHFFFAOYSA-N
Peptide class
Acidic, heat-stable beta-thymosin; G-actin sequestering peptide; sequence identical to UniProt P62328 residues 2 to 44
Solubility
Soluble in water (supplier specification); quantitative solubility not determined
Storage and handling
Store in the original sealed bottle, dry and protected from light, at the temperature stated on the label.
Shelf life
Refer to the lot Certificate of Analysis; re-test date assigned per lot

Analytical verification, lot 26053002-GW5

Tests reported for the current lot on file by Ethos Analytics (released 03/26/2026): HPLC (content against the specification). Only the tests listed below are part of this lot's report.

TestMethodResult
Content per component (label claim 2/0.5/0.5 mg per unit)HPLC2.09/0.53/0.51 mg per unit
Purity reports Endotoxin reports Residual solvent reports Manufacturing process

Safety Data Sheet (SDS)

GHS-format safety data sheet, 16 sections, one per component. Revision 2026-11-04, version 1.0. "No data available" is stated wherever no measured data exist for the substance.

Download SDS (PDF), GHK-CuGHK-Cu, CAS 89030-95-5
1.Identification
Product identifier
GHK-Cu
CAS number
89030-95-5
Product form
Lyophilised peptide, supplied by Licensed Peptides in sealed research packaging; the format of each product (vial, blend component, encapsulated research formulation or atomized solution) is stated on its product page.
Recommended use
Laboratory research reagent for in-vitro use by qualified researchers
Restrictions on use
Not for human or veterinary use. Not a drug, food, cosmetic or household product.
Supplier
Licensed Peptides, Inc., 1489 W Palmetto Park Rd, Boca Raton, FL 33486, USA
Supplier contact
service@licensedpeptides.com, +1 (855) 322-2214 (Mon to Fri, 8:30 AM to 6:30 PM ET)
Emergency telephone
+1 (855) 322-2214 (Mon to Fri, 8:30 AM to 6:30 PM ET). For a medical emergency contact local emergency services or a poison control centre.
2.Hazard identification
GHS classification
Not classified under GHS (Rev. 9) on the basis of the data available for this substance.
Signal word
None
Hazard statements
None assigned
Precautionary statements
None assigned. Handle as a laboratory chemical of unknown toxicity: avoid dust formation, avoid contact with eyes, skin and clothing, do not swallow.
Other hazards
Fine lyophilised powder may form dust. No data available on other hazards.
3.Composition / information on ingredients
Substance / mixture
Substance (synthetic peptide Cu(II) complex)
Chemical name
H-Gly-His-Lys-OH (Cu(II) complex)
Sequence (one-letter)
GHK
Sequence (three-letter)
H-Gly-His-Lys-OH
CAS number
89030-95-5
Molecular formula
C14H23CuN6O4
Concentration
Content as stated on the lot Certificate of Analysis (see /lab-reports/).
Impurities contributing to classification
None known
4.First-aid measures
General advice
Show this safety data sheet to the attending physician. Remove contaminated clothing.
If inhaled
Move the person to fresh air. If breathing is difficult, obtain medical attention.
In case of skin contact
Wash with plenty of soap and water. Obtain medical attention if irritation develops or persists.
In case of eye contact
Rinse cautiously with water for several minutes. Remove contact lenses if present and easy to do. Continue rinsing. Obtain medical attention if irritation persists.
If swallowed
Rinse mouth with water. Do not induce vomiting. Obtain medical attention.
Most important effects, acute and delayed
No data available.
Indication of immediate medical attention
No data available. Care at the discretion of the attending physician.
5.Fire-fighting measures
Suitable extinguishing media
Water spray, dry chemical, carbon dioxide or alcohol-resistant foam, chosen for the surrounding fire.
Unsuitable extinguishing media
None known.
Specific hazards
Organic powder; combustion may release carbon oxides, nitrogen oxides and copper oxides.
Advice for fire-fighters
Wear self-contained breathing apparatus and full fire-fighting gear.
6.Accidental release measures
Personal precautions
Avoid dust formation. Wear gloves, eye protection and a laboratory coat. Ensure adequate ventilation.
Environmental precautions
Do not let the substance enter drains. Quantities supplied are milligram scale.
Containment and clean-up
Sweep up or wipe with a damp cloth without creating dust, place in a closed container for disposal, then clean the area with water.
7.Handling and storage
Precautions for safe handling
Handle in a laboratory setting by trained personnel. Avoid dust formation and contact with skin and eyes. Wash hands after handling. Keep the vial closed when not in use.
Conditions for safe storage
Store lyophilised at -20 °C in the original sealed vial, desiccated and protected from light. Keep away from strong oxidising agents. Short periods at ambient temperature during shipping are tolerated by the lyophilised powder.
Specific end use
Laboratory research reagent only.
8.Exposure controls / personal protection
Occupational exposure limits
None established for this substance.
Engineering controls
Handle the powder in a fume hood or ventilated enclosure. Eyewash station and safety shower should be available.
Eye / face protection
Safety glasses with side shields or chemical goggles (EN 166 or ANSI Z87.1).
Skin protection
Nitrile gloves inspected before use; laboratory coat.
Respiratory protection
Not normally required when handled in a fume hood. For dust-forming operations outside a hood use a particulate respirator (N95 or P2 type).
Hygiene measures
Do not eat, drink or smoke in the laboratory. Wash hands after handling.
9.Physical and chemical properties
Appearance
Blue to violet lyophilised powder
Odour
Odourless
Molecular formula
C14H23CuN6O4
Molecular weight (average)
402.92 g/mol
Monoisotopic mass
402.108 Da
Solubility
Soluble in water (supplier specification). Quantitative solubility: no data available.
pH, melting point, boiling point, flash point, vapour pressure, density, partition coefficient, auto-ignition temperature, decomposition temperature, viscosity
No data available
Flammability
No data available (organic powder, not expected to be readily flammable)
10.Stability and reactivity
Reactivity
No data available.
Chemical stability
Stable under the recommended storage conditions (lyophilised, -20 °C, desiccated, protected from light).
Possibility of hazardous reactions
None known.
Conditions to avoid
Moisture, prolonged exposure to light and elevated temperature; repeated freeze-thaw of solutions.
Incompatible materials
Strong oxidising agents, strong acids and bases.
Hazardous decomposition products
None known under normal storage. Combustion: carbon oxides and nitrogen oxides.
11.Toxicological information
Acute toxicity
No data available for this substance (all exposure routes).
Skin corrosion / irritation
No data available.
Serious eye damage / irritation
No data available.
Respiratory or skin sensitisation
No data available.
Germ cell mutagenicity
No data available.
Carcinogenicity
No data available. Not listed by IARC, NTP or OSHA.
Reproductive toxicity
No data available.
Specific target organ toxicity (single and repeated exposure)
No data available.
Aspiration hazard
No data available.
Additional information
This safety data sheet does not describe biological activity. The substance has not been evaluated for any use other than in-vitro laboratory research.
12.Ecological information
Ecotoxicity
No data available.
Persistence and degradability
No data available. As a peptide it is expected to be hydrolysed by environmental proteases.
Bioaccumulative potential
No data available.
Mobility in soil
No data available.
Other adverse effects
No data available.
13.Disposal considerations
Waste from residues
Dispose of as laboratory chemical waste through a licensed waste disposal contractor in accordance with local, state and federal regulations. Do not discharge to drains.
Contaminated packaging
Dispose of as unused product. Rinsed glass vials may be recycled where local rules allow.
14.Transport information
UN number
Not assigned
UN proper shipping name
Not regulated as a dangerous good
Transport hazard class
Not applicable (DOT, IATA, IMDG)
Packing group
Not applicable
Environmental hazards
Not classified as a marine pollutant
Special precautions
Ship cold-packed; the lyophilised powder tolerates short periods at ambient temperature.
15.Regulatory information
United States (FDA)
This substance is not approved by the US Food and Drug Administration as a drug, food, dietary supplement or cosmetic. It is supplied for in-vitro laboratory research only and is not for human or veterinary use.
OSHA Hazard Communication Standard (29 CFR 1910.1200)
Not classified as hazardous on the basis of available data.
TSCA (US)
Not evaluated. Supplied in research quantities only.
SARA 302 / 313, California Proposition 65
Not listed.
Other
Purchaser must be 21 years of age or older and a qualified researcher. The product may not be used in or on humans or animals.
16.Other information
Revision date
2026-11-04
Version
1.0
Prepared by
Licensed Peptides, Inc. (regulatory and quality documentation)
Data sources
PubChem CID 71587328 (formula, average and monoisotopic mass, InChIKey NZWIFMYRRCMYMN-ACMTZBLWSA-M); lot Certificate of Analysis for purity and content; GHS Revision 9 for section structure.
Disclaimer
The information in this safety data sheet is believed to be accurate as of the revision date and is provided for guidance on safe handling, storage and disposal in a laboratory setting. It is not a specification and does not constitute a warranty. The recipient is responsible for determining the suitability of the substance for the intended research application and for compliance with all applicable regulations.
Download SDS (PDF), BPC-157BPC-157, CAS 137525-51-0
1.Identification
Product identifier
BPC-157
CAS number
137525-51-0
Product form
Lyophilised peptide, supplied by Licensed Peptides in sealed research packaging; the format of each product (vial, blend component, encapsulated research formulation or atomized solution) is stated on its product page.
Recommended use
Laboratory research reagent for in-vitro use by qualified researchers
Restrictions on use
Not for human or veterinary use. Not a drug, food, cosmetic or household product.
Supplier
Licensed Peptides, Inc., 1489 W Palmetto Park Rd, Boca Raton, FL 33486, USA
Supplier contact
service@licensedpeptides.com, +1 (855) 322-2214 (Mon to Fri, 8:30 AM to 6:30 PM ET)
Emergency telephone
+1 (855) 322-2214 (Mon to Fri, 8:30 AM to 6:30 PM ET). For a medical emergency contact local emergency services or a poison control centre.
2.Hazard identification
GHS classification
Not classified under GHS (Rev. 9) on the basis of the data available for this substance.
Signal word
None
Hazard statements
None assigned
Precautionary statements
None assigned. Handle as a laboratory chemical of unknown toxicity: avoid dust formation, avoid contact with eyes, skin and clothing, do not swallow.
Other hazards
Fine lyophilised powder may form dust. No data available on other hazards.
3.Composition / information on ingredients
Substance / mixture
Substance (synthetic peptide), may contain counter-ion and residual water from lyophilisation
Chemical name
H-Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val-OH
Sequence (one-letter)
GEPPPGKPADDAGLV
Sequence (three-letter)
H-Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val-OH
CAS number
137525-51-0
Molecular formula
C62H98N16O22
Concentration
Content as stated on the lot Certificate of Analysis (see /lab-reports/).
Impurities contributing to classification
None known
4.First-aid measures
General advice
Show this safety data sheet to the attending physician. Remove contaminated clothing.
If inhaled
Move the person to fresh air. If breathing is difficult, obtain medical attention.
In case of skin contact
Wash with plenty of soap and water. Obtain medical attention if irritation develops or persists.
In case of eye contact
Rinse cautiously with water for several minutes. Remove contact lenses if present and easy to do. Continue rinsing. Obtain medical attention if irritation persists.
If swallowed
Rinse mouth with water. Do not induce vomiting. Obtain medical attention.
Most important effects, acute and delayed
No data available.
Indication of immediate medical attention
No data available. Care at the discretion of the attending physician.
5.Fire-fighting measures
Suitable extinguishing media
Water spray, dry chemical, carbon dioxide or alcohol-resistant foam, chosen for the surrounding fire.
Unsuitable extinguishing media
None known.
Specific hazards
Organic powder; combustion may release carbon oxides and nitrogen oxides.
Advice for fire-fighters
Wear self-contained breathing apparatus and full fire-fighting gear.
6.Accidental release measures
Personal precautions
Avoid dust formation. Wear gloves, eye protection and a laboratory coat. Ensure adequate ventilation.
Environmental precautions
Do not let the substance enter drains. Quantities supplied are milligram scale.
Containment and clean-up
Sweep up or wipe with a damp cloth without creating dust, place in a closed container for disposal, then clean the area with water.
7.Handling and storage
Precautions for safe handling
Handle in a laboratory setting by trained personnel. Avoid dust formation and contact with skin and eyes. Wash hands after handling. Keep the vial closed when not in use.
Conditions for safe storage
Store lyophilised at -20 °C in the original sealed vial, desiccated and protected from light. Keep away from strong oxidising agents. Short periods at ambient temperature during shipping are tolerated by the lyophilised powder.
Specific end use
Laboratory research reagent only.
8.Exposure controls / personal protection
Occupational exposure limits
None established for this substance.
Engineering controls
Handle the powder in a fume hood or ventilated enclosure. Eyewash station and safety shower should be available.
Eye / face protection
Safety glasses with side shields or chemical goggles (EN 166 or ANSI Z87.1).
Skin protection
Nitrile gloves inspected before use; laboratory coat.
Respiratory protection
Not normally required when handled in a fume hood. For dust-forming operations outside a hood use a particulate respirator (N95 or P2 type).
Hygiene measures
Do not eat, drink or smoke in the laboratory. Wash hands after handling.
9.Physical and chemical properties
Appearance
White to off-white lyophilised powder
Odour
Odourless
Molecular formula
C62H98N16O22
Molecular weight (average)
1419.5 g/mol
Monoisotopic mass
1418.704 Da
Solubility
Soluble in water (supplier specification). Quantitative solubility: no data available.
pH, melting point, boiling point, flash point, vapour pressure, density, partition coefficient, auto-ignition temperature, decomposition temperature, viscosity
No data available
Flammability
No data available (organic powder, not expected to be readily flammable)
10.Stability and reactivity
Reactivity
No data available.
Chemical stability
Stable under the recommended storage conditions (lyophilised, -20 °C, desiccated, protected from light).
Possibility of hazardous reactions
None known.
Conditions to avoid
Moisture, prolonged exposure to light and elevated temperature; repeated freeze-thaw of solutions.
Incompatible materials
Strong oxidising agents, strong acids and bases.
Hazardous decomposition products
None known under normal storage. Combustion: carbon oxides and nitrogen oxides.
11.Toxicological information
Acute toxicity
No data available for this substance (all exposure routes).
Skin corrosion / irritation
No data available.
Serious eye damage / irritation
No data available.
Respiratory or skin sensitisation
No data available.
Germ cell mutagenicity
No data available.
Carcinogenicity
No data available. Not listed by IARC, NTP or OSHA.
Reproductive toxicity
No data available.
Specific target organ toxicity (single and repeated exposure)
No data available.
Aspiration hazard
No data available.
Additional information
This safety data sheet does not describe biological activity. The substance has not been evaluated for any use other than in-vitro laboratory research.
12.Ecological information
Ecotoxicity
No data available.
Persistence and degradability
No data available. As a peptide it is expected to be hydrolysed by environmental proteases.
Bioaccumulative potential
No data available.
Mobility in soil
No data available.
Other adverse effects
No data available.
13.Disposal considerations
Waste from residues
Dispose of as laboratory chemical waste through a licensed waste disposal contractor in accordance with local, state and federal regulations. Do not discharge to drains.
Contaminated packaging
Dispose of as unused product. Rinsed glass vials may be recycled where local rules allow.
14.Transport information
UN number
Not assigned
UN proper shipping name
Not regulated as a dangerous good
Transport hazard class
Not applicable (DOT, IATA, IMDG)
Packing group
Not applicable
Environmental hazards
Not classified as a marine pollutant
Special precautions
Ship cold-packed; the lyophilised powder tolerates short periods at ambient temperature.
15.Regulatory information
United States (FDA)
This substance is not approved by the US Food and Drug Administration as a drug, food, dietary supplement or cosmetic. It is supplied for in-vitro laboratory research only and is not for human or veterinary use.
OSHA Hazard Communication Standard (29 CFR 1910.1200)
Not classified as hazardous on the basis of available data.
TSCA (US)
Not evaluated. Supplied in research quantities only.
SARA 302 / 313, California Proposition 65
Not listed.
Other
Purchaser must be 21 years of age or older and a qualified researcher. The product may not be used in or on humans or animals.
16.Other information
Revision date
2026-11-04
Version
1.0
Prepared by
Licensed Peptides, Inc. (regulatory and quality documentation)
Data sources
PubChem CID 9941957 (formula, average and monoisotopic mass, InChIKey HEEWEZGQMLZMFE-RKGINYAYSA-N); lot Certificate of Analysis for purity and content; GHS Revision 9 for section structure.
Disclaimer
The information in this safety data sheet is believed to be accurate as of the revision date and is provided for guidance on safe handling, storage and disposal in a laboratory setting. It is not a specification and does not constitute a warranty. The recipient is responsible for determining the suitability of the substance for the intended research application and for compliance with all applicable regulations.
Download SDS (PDF), TB-500TB-500 (thymosin beta-4), CAS 77591-33-4
1.Identification
Product identifier
TB-500 (thymosin beta-4)
CAS number
77591-33-4
Product form
Lyophilised peptide, supplied by Licensed Peptides in sealed research packaging; the format of each product (vial, blend component, encapsulated research formulation or atomized solution) is stated on its product page.
Recommended use
Laboratory research reagent for in-vitro use by qualified researchers
Restrictions on use
Not for human or veterinary use. Not a drug, food, cosmetic or household product.
Supplier
Licensed Peptides, Inc., 1489 W Palmetto Park Rd, Boca Raton, FL 33486, USA
Supplier contact
service@licensedpeptides.com, +1 (855) 322-2214 (Mon to Fri, 8:30 AM to 6:30 PM ET)
Emergency telephone
+1 (855) 322-2214 (Mon to Fri, 8:30 AM to 6:30 PM ET). For a medical emergency contact local emergency services or a poison control centre.
2.Hazard identification
GHS classification
Not classified under GHS (Rev. 9) on the basis of the data available for this substance.
Signal word
None
Hazard statements
None assigned
Precautionary statements
None assigned. Handle as a laboratory chemical of unknown toxicity: avoid dust formation, avoid contact with eyes, skin and clothing, do not swallow.
Other hazards
Fine lyophilised powder may form dust. No data available on other hazards.
3.Composition / information on ingredients
Substance / mixture
Substance (synthetic peptide), may contain counter-ion and residual water from lyophilisation
Chemical name
Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH
Sequence (one-letter)
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Sequence (three-letter)
Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH
CAS number
77591-33-4
Molecular formula
C212H350N56O78S
Concentration
Content as stated on the lot Certificate of Analysis (see /lab-reports/).
Impurities contributing to classification
None known
4.First-aid measures
General advice
Show this safety data sheet to the attending physician. Remove contaminated clothing.
If inhaled
Move the person to fresh air. If breathing is difficult, obtain medical attention.
In case of skin contact
Wash with plenty of soap and water. Obtain medical attention if irritation develops or persists.
In case of eye contact
Rinse cautiously with water for several minutes. Remove contact lenses if present and easy to do. Continue rinsing. Obtain medical attention if irritation persists.
If swallowed
Rinse mouth with water. Do not induce vomiting. Obtain medical attention.
Most important effects, acute and delayed
No data available.
Indication of immediate medical attention
No data available. Care at the discretion of the attending physician.
5.Fire-fighting measures
Suitable extinguishing media
Water spray, dry chemical, carbon dioxide or alcohol-resistant foam, chosen for the surrounding fire.
Unsuitable extinguishing media
None known.
Specific hazards
Organic powder; combustion may release carbon oxides, nitrogen oxides and sulfur oxides.
Advice for fire-fighters
Wear self-contained breathing apparatus and full fire-fighting gear.
6.Accidental release measures
Personal precautions
Avoid dust formation. Wear gloves, eye protection and a laboratory coat. Ensure adequate ventilation.
Environmental precautions
Do not let the substance enter drains. Quantities supplied are milligram scale.
Containment and clean-up
Sweep up or wipe with a damp cloth without creating dust, place in a closed container for disposal, then clean the area with water.
7.Handling and storage
Precautions for safe handling
Handle in a laboratory setting by trained personnel. Avoid dust formation and contact with skin and eyes. Wash hands after handling. Keep the vial closed when not in use.
Conditions for safe storage
Store lyophilised at -20 °C in the original sealed vial, desiccated and protected from light. Keep away from strong oxidising agents. Short periods at ambient temperature during shipping are tolerated by the lyophilised powder.
Specific end use
Laboratory research reagent only.
8.Exposure controls / personal protection
Occupational exposure limits
None established for this substance.
Engineering controls
Handle the powder in a fume hood or ventilated enclosure. Eyewash station and safety shower should be available.
Eye / face protection
Safety glasses with side shields or chemical goggles (EN 166 or ANSI Z87.1).
Skin protection
Nitrile gloves inspected before use; laboratory coat.
Respiratory protection
Not normally required when handled in a fume hood. For dust-forming operations outside a hood use a particulate respirator (N95 or P2 type).
Hygiene measures
Do not eat, drink or smoke in the laboratory. Wash hands after handling.
9.Physical and chemical properties
Appearance
White to off-white lyophilised powder
Odour
Odourless
Molecular formula
C212H350N56O78S
Molecular weight (average)
4963.5 g/mol
Monoisotopic mass
4960.486 Da
Solubility
Soluble in water (supplier specification). Quantitative solubility: no data available.
pH, melting point, boiling point, flash point, vapour pressure, density, partition coefficient, auto-ignition temperature, decomposition temperature, viscosity
No data available
Flammability
No data available (organic powder, not expected to be readily flammable)
10.Stability and reactivity
Reactivity
No data available.
Chemical stability
Stable under the recommended storage conditions (lyophilised, -20 °C, desiccated, protected from light).
Possibility of hazardous reactions
None known.
Conditions to avoid
Moisture, prolonged exposure to light and elevated temperature; repeated freeze-thaw of solutions.
Incompatible materials
Strong oxidising agents, strong acids and bases.
Hazardous decomposition products
None known under normal storage. Combustion: carbon oxides and nitrogen oxides.
11.Toxicological information
Acute toxicity
No data available for this substance (all exposure routes).
Skin corrosion / irritation
No data available.
Serious eye damage / irritation
No data available.
Respiratory or skin sensitisation
No data available.
Germ cell mutagenicity
No data available.
Carcinogenicity
No data available. Not listed by IARC, NTP or OSHA.
Reproductive toxicity
No data available.
Specific target organ toxicity (single and repeated exposure)
No data available.
Aspiration hazard
No data available.
Additional information
This safety data sheet does not describe biological activity. The substance has not been evaluated for any use other than in-vitro laboratory research.
12.Ecological information
Ecotoxicity
No data available.
Persistence and degradability
No data available. As a peptide it is expected to be hydrolysed by environmental proteases.
Bioaccumulative potential
No data available.
Mobility in soil
No data available.
Other adverse effects
No data available.
13.Disposal considerations
Waste from residues
Dispose of as laboratory chemical waste through a licensed waste disposal contractor in accordance with local, state and federal regulations. Do not discharge to drains.
Contaminated packaging
Dispose of as unused product. Rinsed glass vials may be recycled where local rules allow.
14.Transport information
UN number
Not assigned
UN proper shipping name
Not regulated as a dangerous good
Transport hazard class
Not applicable (DOT, IATA, IMDG)
Packing group
Not applicable
Environmental hazards
Not classified as a marine pollutant
Special precautions
Ship cold-packed; the lyophilised powder tolerates short periods at ambient temperature.
15.Regulatory information
United States (FDA)
This substance is not approved by the US Food and Drug Administration as a drug, food, dietary supplement or cosmetic. It is supplied for in-vitro laboratory research only and is not for human or veterinary use.
OSHA Hazard Communication Standard (29 CFR 1910.1200)
Not classified as hazardous on the basis of available data.
TSCA (US)
Not evaluated. Supplied in research quantities only.
SARA 302 / 313, California Proposition 65
Not listed.
Other
Purchaser must be 21 years of age or older and a qualified researcher. The product may not be used in or on humans or animals.
16.Other information
Revision date
2026-11-04
Version
1.0
Prepared by
Licensed Peptides, Inc. (regulatory and quality documentation)
Data sources
PubChem CID 45382195 (formula, average and monoisotopic mass, InChIKey UGPMCIBIHRSCBV-UHFFFAOYSA-N); UniProt P62328 for the sequence; lot Certificate of Analysis for purity and content; GHS Revision 9 for section structure.
Disclaimer
The information in this safety data sheet is believed to be accurate as of the revision date and is provided for guidance on safe handling, storage and disposal in a laboratory setting. It is not a specification and does not constitute a warranty. The recipient is responsible for determining the suitability of the substance for the intended research application and for compliance with all applicable regulations.
Intended use. This product is not a drug, food, dietary supplement or cosmetic. It is supplied as an encapsulated research formulation (laboratory reagent) for in-vitro research by qualified researchers only and is not for human or veterinary use. The statements on this page have not been evaluated by the US Food and Drug Administration, and the product is not intended to diagnose, treat, cure or prevent any disease. Purchasers must be 21 years of age or older. Licensed Peptides is a chemical supplier, not a pharmacy.
99%+ Purity
99%+ Purity

Guaranteed per batch

HPLC + LAL
HPLC + LAL

Independent lab verified

Endotoxin-Free
Endotoxin-Free

Ethos Analytics · ISO/IEC 17025

GMP-Certified
GMP-Certified

USA-manufactured

Same-Day Shipping
Same-Day Shipping

Free FedEx on $200+

Vendor Comparison

Why Researchers Choose Licensed Peptides

Not all peptide vendors hold themselves to the same verification standards.

Verification Standard Licensed Peptides Generic Vendors
HPLC Purity Analysis ✓ 99%+ Every Batch ✗ Often Not Disclosed
Endotoxin Screening (LAL) ✓ Every Product ✗ Industry Exception
GMP-Certified USA Manufacture ✓ ISO 9001:2015 ✗ Often Overseas
COA Published & Downloadable ✓ Every Lot ✗ Inconsistent
Same-Day USA Fulfillment ✓ Before 4PM PST ✗ 3-10 Day Lead Time
Research Questions

Frequently Asked Questions

Glow Blend is a peptide research formulation combining BPC-157, TB-500, and GHKCu for laboratory and educational research exploring cellular signaling and pathway behavior.

No. None of the peptides in the Glow Blend are approved as drugs, supplements, treatments, cosmetics, or medical products. They are strictly for research purposes only.

Researchers may study these peptides together to compare localized signaling behavior with broader structural pathway responses in controlled experimental models.

GHK-Cu is studied for its relationship to peptide-copper interactions, gene-expression responses, and extracellular-matrix-related research models.

No. Outcomes vary across studies depending on model design, peptide concentration, duration, and experimental conditions. All research remains exploratory.

Absolutely not. Glow Blend is not intended for human or animal use under any circumstance.

No. While well known for cosmetic science, GHK-Cu is also studied for wound repair models, inflammatory regulation, copper metabolism, and broad gene modulation.

Research suggests they function via separate biological mechanisms. Their potential complementary nature is the basis for combination studies, but definitive interaction outcomes are not established.

No single peptide is considered superior. Each addresses different biological pathways, which is why researchers often study them together rather than individually.

Safety cannot be established outside of controlled laboratory research. Proper handling, storage, and use in qualified research environments are essential.

Glow Blend combines three well-documented peptides with extensive scientific literature, making it a compelling subject for studies involving tissue modeling, repair signaling, and skin-related biochemical pathways.

High Purity refers to peptide material refined to minimize unrelated molecular species, supporting consistency in analytical assays and experimental reproducibility. This designation applies strictly to laboratory research use.

LPS-free peptide and Endotoxin-free peptide specifications help reduce confounding variables in experimental models, particularly in studies involving inflammatory or signaling pathways, ensuring cleaner interpretation of laboratory data.

Yes. Glow Blend (70 mg) is supplied as research peptides endotoxin tested, supporting quality assurance for laboratory, analytical and educational research applications only.

Frequently Paired With

Researchers Also Order

Not all peptide vendors hold themselves to the same verification standards.

Order Today

Research-Grade
Glow (GHKcu 2mg/BPC 500mcg/TB 500mcg) Ships Same Day

99.4% HPLC Verified · Endotoxin-Screened · GMP-Certified ·
Free FedEx 2-Day on $200+

View Full COA

You cannot copy content of this page