2 for 1 sale You pick the included one Any vial, any size. NO CODE, NO LIMITS.

Need help? Call Or Text us, and a team member will be happy to assist you. +1 (855) 322-2214

Total Price $1,009.26

Discounted Price $676.20

Vials 5 vials

You Save

$333.06 33% OFF

On Sale!

BPC157, TB500, GHKCu, KPV (Klow Blend) 80mg – Licensed Peptides

BPC157, TB500, GHKCu, KPV (Klow Blend) 80mg – image 1

BPC157, TB500, GHKCu, KPV (Klow Blend) 80mg – lab report

⚠ Peptide Blends ⚠ Synthetic Peptides

Retail Price $597.54

Your Price $597.54 Per vial: $42.58

You Save $597.54 33% OFF

Select Strength (mg)

99% HPLC Purity

Select Vials

Bulk pricing applied

1 Vial

—

Total: $212.90 Highest cost per vial Starter 3 Vials

—

Total: $212.90 ★ Most Popular 5 Vials

$199.99 —

Total: $212.90 Best for ongoing research Best Value 10 Vials

$199.99 —

Total: $212.90 Lowest price per vial

📈 Upgrade to 10 vials and save an extra vs. buying 5 — nearly 3 vials included.

Your included vial Included · 2 for 1

BPC157, TB500, GHKCu, KPV (Klow Blend) 80mg

Same as above

Included

99%+ HPLC Purity — Independently verified by accredited US laboratory
Endotoxin-Screened — LAL tested, LPS-free, endotoxin report available
GMP-Certified Manufacturing — USA facility, ISO 9001:2015
Lyophilized for Stability — Shipped cold-packed, intact for reconstitution

Molecular Weight

Third Party Tested

APPLICATION

For Research Use only

Form

Lyophilized Powder

Storage

-20°C Long Term

Purity (HPLC)

99%+ Third Party Verified

Manufacture

USA / GMP

BPC157, TB500, GHKCu, KPV (Klow Blend) · 80mg

Total Price $1,009.26

Discounted Price $676.20

Vials 5 vials

You Save

$333.06 33% OFF

⚠ Peptide Blends ⚠ Synthetic Peptides

Select Strength (mg)

99% HPLC Purity

Select Vials

Bulk pricing applied

1 Vial

—

Total: $212.90 Highest cost per vial Starter 3 Vials

—

Total: $212.90 ★ Most Popular 5 Vials

$199.99 —

Total: $212.90 Best for ongoing research Best Value 10 Vials

$199.99 —

Total: $212.90 Lowest price per vial

📈 Upgrade to 10 vials and save an extra vs. buying 5 — nearly 3 vials included.

Your included vial Included · 2 for 1

BPC157, TB500, GHKCu, KPV (Klow Blend) 80mg

Same as above

Included

99%+ HPLC Purity — Independently verified by accredited US laboratory
Endotoxin-Screened — LAL tested, LPS-free, endotoxin report available
GMP-Certified Manufacturing — USA facility, ISO 9001:2015
Lyophilized for Stability — Shipped cold-packed, intact for reconstitution

Molecular Weight

Third Party Tested

APPLICATION

For Research Use only

Form

Lyophilized Powder

Storage

-20°C Long Term

Purity (HPLC)

99%+ Third Party Verified

Manufacture

USA / GMP

Reagent documentation

Scientific description

Structure, physicochemical data, analytical verification and safety documentation for the 4 components of this product (GHK-Cu, BPC-157, TB-500, KPV). Supplied for in-vitro laboratory research only.

Reagent overview
Molecular structure
Physicochemical data
Analytical verification
Published research
Safety Data Sheet
Intended use

Reagent overview

Reagent

BPC157, TB500, GHKCu, KPV (Klow Blend) 80mg

Composition

80 mg vial: 50 mg GHK-Cu + 10 mg BPC-157 + 10 mg TB-500 + 10 mg KPV

Form

Lyophilised powder, sealed vial

Chromatographic purity, current lot

>99.50%

CAS, GHK-Cu

89030-95-5

CAS, BPC-157

137525-51-0

CAS, TB-500

77591-33-4

CAS, KPV

67727-97-3

Lot on file

V260309-11Released 3/25/2026

Testing laboratory

Vanguard Laboratory, ISO/IEC 17025:2017, A2LA #6377.01.01

Download COA (PDF) Verify with Vanguard Laboratory Lot record in the Testing Library

Molecular structure

Two-dimensional structures generated with RDKit and drawn in the site palette. Tap a drawing to enlarge it. Below each drawing, the residue chain in one-letter code with the three-letter name and position; colours mark the side-chain class, a dashed outline marks a D-residue or a non-proteinogenic residue (lower-case letters are D-residues).

Acidic (Asp, Glu)Basic (Lys, Arg, His)Polar uncharged (Ser, Thr, Asn, Gln, Cys, Tyr)Hydrophobic (Ala, Val, Leu, Ile, Met, Phe, Trp)Gly / ProD- or non-proteinogenic residue

GHK-Cu Copper(II) complex of glycyl-L-histidyl-L-lysine

Tap to enlarge

2D depiction, C₁₄H₂₃CuN₆O₄, generated from the PubChem connection table, CID 71587328.

HGGly1HHis2KLys3OHCu(II)

H-Gly-His-Lys-OH

BPC-157 Pentadecapeptide BPC-157

Tap to enlarge

2D depiction, C₆₂H₉₈N₁₆O₂₂, generated from the PubChem connection table, CID 9941957.

HGGly1EGlu2PPro3PPro4PPro5GGly6KLys7PPro8AAla9DAsp10DAsp11AAla12GGly13LLeu14VVal15OH

H-Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val-OH

TB-500 (thymosin beta-4) N-acetyl thymosin beta-4, 43 residues

Tap to enlarge

2D depiction, C₂₁₂H₃₅₀N₅₆O₇₈S, generated from the PubChem connection table, CID 45382195.

AcSSer1DAsp2KLys3PPro4DAsp5MMet6AAla7EGlu8IIle9EGlu10KLys11FPhe12DAsp13KLys14SSer15KLys16LLeu17KLys18KLys19TThr20EGlu21TThr22QGln23EGlu24KLys25NAsn26PPro27LLeu28PPro29SSer30KLys31EGlu32TThr33IIle34EGlu35QGln36EGlu37KLys38QGln39AAla40GGly41EGlu42SSer43OH

Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH (terminal groups: N-terminal acetyl, C-terminal acid)

KPV Tripeptide Lys-Pro-Val

Tap to enlarge

2D depiction, C₁₆H₃₀N₄O₄, generated from the PubChem connection table, CID 125672.

HKLys1PPro2VVal3OH

H-Lys-Pro-Val-OH

Physicochemical data

Formula, masses and identifiers from PubChem where a record exists, checked against an independent RDKit calculation and, for peptides, against the residue sequence. Theoretical pI, net charge at pH 7.4, GRAVY and the 280 nm extinction coefficient are calculated with Biopython ProtParam on the residue chain (Bjellqvist pK set; Kyte-Doolittle; Gill and von Hippel) and are marked "calculated"; they are not given where the chain contains non-proteinogenic residues.

GHK-Cu

Molecular formula

C₁₄H₂₃CuN₆O₄ (salt / complex as in the PubChem record)

Average molecular weight

402.92 g/mol

Monoisotopic mass

402.108 Da

CAS number

89030-95-5

Sequence length

3 residues

PubChem CID

71587328

InChIKey

NZWIFMYRRCMYMN-ACMTZBLWSA-M

Peptide class

Copper(II) complex of the tripeptide Gly-His-Lys (1:1)

Appearance

Blue to violet lyophilised powder

Solubility

Soluble in water (supplier specification); quantitative solubility not determined

Storage and handling

Store at -20 °C, desiccated and protected from light. The sealed powder tolerates short periods at ambient temperature during shipping.

Shelf life

Refer to the lot Certificate of Analysis; re-test date assigned per lot

BPC-157

Molecular formula

C₆₂H₉₈N₁₆O₂₂

Average molecular weight

1419.5 g/mol

Monoisotopic mass

1418.704 Da

CAS number

137525-51-0

Sequence length

15 residues

Theoretical pI (calculated)

4.05

Net charge at pH 7.4 (calculated)

-2.4

GRAVY hydropathy (calculated)

-0.693

Extinction coefficient, 280 nm (calculated)

0 M^-1 cm^-1 (no Trp, Tyr or Cys)

PubChem CID

9941957

InChIKey

HEEWEZGQMLZMFE-RKGINYAYSA-N

Peptide class

Synthetic linear pentadecapeptide; partial sequence of a protein isolated from human gastric juice

Appearance

White to off-white lyophilised powder

Solubility

Soluble in water (supplier specification); quantitative solubility not determined

Storage and handling

Store at -20 °C, desiccated and protected from light. The sealed powder tolerates short periods at ambient temperature during shipping.

Shelf life

Refer to the lot Certificate of Analysis; re-test date assigned per lot

TB-500 (thymosin beta-4)

Molecular formula

C₂₁₂H₃₅₀N₅₆O₇₈S

Average molecular weight

4963.5 g/mol

Monoisotopic mass

4960.486 Da

CAS number

77591-33-4

Sequence length

43 residues, N-terminal acetyl

Theoretical pI (calculated)

5.02 (free-terminus model)

Net charge at pH 7.4 (calculated)

-2.8

GRAVY hydropathy (calculated)

-1.702

Extinction coefficient, 280 nm (calculated)

0 M^-1 cm^-1 (no Trp, Tyr or Cys)

PubChem CID

45382195

InChIKey

UGPMCIBIHRSCBV-UHFFFAOYSA-N

Peptide class

Acidic, heat-stable beta-thymosin; G-actin sequestering peptide; sequence identical to UniProt P62328 residues 2 to 44

Appearance

White to off-white lyophilised powder

Solubility

Soluble in water (supplier specification); quantitative solubility not determined

Storage and handling

Store at -20 °C, desiccated and protected from light. The sealed powder tolerates short periods at ambient temperature during shipping.

Shelf life

Refer to the lot Certificate of Analysis; re-test date assigned per lot

KPV

Molecular formula

C₁₆H₃₀N₄O₄

Average molecular weight

342.43 g/mol

Monoisotopic mass

342.227 Da

CAS number

67727-97-3

Sequence length

3 residues

Theoretical pI (calculated)

8.75

Net charge at pH 7.4 (calculated)

+0.6

GRAVY hydropathy (calculated)

-0.433

Extinction coefficient, 280 nm (calculated)

0 M^-1 cm^-1 (no Trp, Tyr or Cys)

PubChem CID

125672

InChIKey

YSPZCHGIWAQVKQ-AVGNSLFASA-N

Peptide class

Linear tripeptide (Lys-Pro-Val)

Appearance

White to off-white lyophilised powder

Solubility

Soluble in water (supplier specification); quantitative solubility not determined

Storage and handling

Store at -20 °C, desiccated and protected from light. The sealed powder tolerates short periods at ambient temperature during shipping.

Shelf life

Refer to the lot Certificate of Analysis; re-test date assigned per lot

Analytical verification, lot V260309-11

Tests reported for the current lot on file by Vanguard Laboratory, ISO/IEC 17025:2017, A2LA #6377.01.01 (released 3/25/2026): reversed-phase HPLC with UV detection (chromatographic purity by peak area, content against the label claim); ICP-MS heavy metals. Only the tests listed below are part of this lot's report.

HPLC-UV chromatogram from the Certificate of Analysis, lot V260309-11

Tap to enlarge

HPLC-UV chromatogram, full trace, from page 1 of the lot Certificate of Analysis (diode-array detector, 214 nm).

Test	Method	Result
Chromatographic purity (blend, combined peak area)	HPLC-UV/VIS	>99.50%
Content per component (label claim 80 mg total)	HPLC-UV/VIS	GHK-Cu 50.77 mg \| BPC-157 11.19 mg \| TB-500 11.35 mg \| KPV 12.41 mg
Heavy metals	ICP-MS	Arsenic ND (LOQ 0.015 ppm), Cadmium ND (LOQ 0.015 ppm), Lead ND (LOQ 0.015 ppm), Mercury ND (LOQ 0.005 ppm)

Blend purity is the combined chromatographic area percent of the peaks identified as the intended components; it does not establish individual component purity or ratio.

Purity reports Endotoxin reports Residual solvent reports Manufacturing process

Published research

Summaries of published papers, written for qualified researchers. They describe the published work, not this product.

Peptide chemistryGHK-Cu: copper(II) coordination chemistry of the Gly-His-Lys tripeptide, a published study summaryRead study →In-vitro studiesBPC-157 in cultured rat tendon fibroblasts: a published study summaryRead study →In-vitro studiesThymosin beta-4 (TB-500) in endothelial cell migration assays: a published study summaryRead study →In-vitro studiesKPV in intestinal epithelial cell lines: PepT1 transport and NF-kB reporter assays, a published study summaryRead study →

Safety Data Sheet (SDS)

GHS-format safety data sheet, 16 sections, one per component. Revision 2026-11-04, version 1.0. "No data available" is stated wherever no measured data exist for the substance.

Download SDS (PDF), GHK-CuGHK-Cu, CAS 89030-95-5

1.Identification

Product identifier: GHK-Cu
CAS number: 89030-95-5
Product form: Lyophilised peptide, supplied by Licensed Peptides in sealed research packaging; the format of each product (vial, blend component, encapsulated research formulation or atomized solution) is stated on its product page.
Recommended use: Laboratory research reagent for in-vitro use by qualified researchers
Restrictions on use: Not for human or veterinary use. Not a drug, food, cosmetic or household product.
Supplier: Licensed Peptides, Inc., 1489 W Palmetto Park Rd, Boca Raton, FL 33486, USA
Supplier contact: service@licensedpeptides.com, +1 (855) 322-2214 (Mon to Fri, 8:30 AM to 6:30 PM ET)
Emergency telephone: +1 (855) 322-2214 (Mon to Fri, 8:30 AM to 6:30 PM ET). For a medical emergency contact local emergency services or a poison control centre.

2.Hazard identification

GHS classification: Not classified under GHS (Rev. 9) on the basis of the data available for this substance.
Signal word: None
Hazard statements: None assigned
Precautionary statements: None assigned. Handle as a laboratory chemical of unknown toxicity: avoid dust formation, avoid contact with eyes, skin and clothing, do not swallow.
Other hazards: Fine lyophilised powder may form dust. No data available on other hazards.

3.Composition / information on ingredients

Substance / mixture: Substance (synthetic peptide Cu(II) complex)
Chemical name: H-Gly-His-Lys-OH (Cu(II) complex)
Sequence (one-letter): GHK
Sequence (three-letter): H-Gly-His-Lys-OH
CAS number: 89030-95-5
Molecular formula: C14H23CuN6O4
Concentration: Content as stated on the lot Certificate of Analysis (see /lab-reports/).
Impurities contributing to classification: None known

4.First-aid measures

General advice: Show this safety data sheet to the attending physician. Remove contaminated clothing.
If inhaled: Move the person to fresh air. If breathing is difficult, obtain medical attention.
In case of skin contact: Wash with plenty of soap and water. Obtain medical attention if irritation develops or persists.
In case of eye contact: Rinse cautiously with water for several minutes. Remove contact lenses if present and easy to do. Continue rinsing. Obtain medical attention if irritation persists.
If swallowed: Rinse mouth with water. Do not induce vomiting. Obtain medical attention.
Most important effects, acute and delayed: No data available.
Indication of immediate medical attention: No data available. Care at the discretion of the attending physician.

5.Fire-fighting measures

Suitable extinguishing media: Water spray, dry chemical, carbon dioxide or alcohol-resistant foam, chosen for the surrounding fire.
Unsuitable extinguishing media: None known.
Specific hazards: Organic powder; combustion may release carbon oxides, nitrogen oxides and copper oxides.
Advice for fire-fighters: Wear self-contained breathing apparatus and full fire-fighting gear.

6.Accidental release measures

Personal precautions: Avoid dust formation. Wear gloves, eye protection and a laboratory coat. Ensure adequate ventilation.
Environmental precautions: Do not let the substance enter drains. Quantities supplied are milligram scale.
Containment and clean-up: Sweep up or wipe with a damp cloth without creating dust, place in a closed container for disposal, then clean the area with water.

7.Handling and storage

Precautions for safe handling: Handle in a laboratory setting by trained personnel. Avoid dust formation and contact with skin and eyes. Wash hands after handling. Keep the vial closed when not in use.
Conditions for safe storage: Store lyophilised at -20 °C in the original sealed vial, desiccated and protected from light. Keep away from strong oxidising agents. Short periods at ambient temperature during shipping are tolerated by the lyophilised powder.
Specific end use: Laboratory research reagent only.

8.Exposure controls / personal protection

Occupational exposure limits: None established for this substance.
Engineering controls: Handle the powder in a fume hood or ventilated enclosure. Eyewash station and safety shower should be available.
Eye / face protection: Safety glasses with side shields or chemical goggles (EN 166 or ANSI Z87.1).
Skin protection: Nitrile gloves inspected before use; laboratory coat.
Respiratory protection: Not normally required when handled in a fume hood. For dust-forming operations outside a hood use a particulate respirator (N95 or P2 type).
Hygiene measures: Do not eat, drink or smoke in the laboratory. Wash hands after handling.

9.Physical and chemical properties

Appearance: Blue to violet lyophilised powder
Odour: Odourless
Molecular formula: C14H23CuN6O4
Molecular weight (average): 402.92 g/mol
Monoisotopic mass: 402.108 Da
Solubility: Soluble in water (supplier specification). Quantitative solubility: no data available.
pH, melting point, boiling point, flash point, vapour pressure, density, partition coefficient, auto-ignition temperature, decomposition temperature, viscosity: No data available
Flammability: No data available (organic powder, not expected to be readily flammable)

10.Stability and reactivity

Reactivity: No data available.
Chemical stability: Stable under the recommended storage conditions (lyophilised, -20 °C, desiccated, protected from light).
Possibility of hazardous reactions: None known.
Conditions to avoid: Moisture, prolonged exposure to light and elevated temperature; repeated freeze-thaw of solutions.
Incompatible materials: Strong oxidising agents, strong acids and bases.
Hazardous decomposition products: None known under normal storage. Combustion: carbon oxides and nitrogen oxides.

11.Toxicological information

Acute toxicity: No data available for this substance (all exposure routes).
Skin corrosion / irritation: No data available.
Serious eye damage / irritation: No data available.
Respiratory or skin sensitisation: No data available.
Germ cell mutagenicity: No data available.
Carcinogenicity: No data available. Not listed by IARC, NTP or OSHA.
Reproductive toxicity: No data available.
Specific target organ toxicity (single and repeated exposure): No data available.
Aspiration hazard: No data available.
Additional information: This safety data sheet does not describe biological activity. The substance has not been evaluated for any use other than in-vitro laboratory research.

12.Ecological information

Ecotoxicity: No data available.
Persistence and degradability: No data available. As a peptide it is expected to be hydrolysed by environmental proteases.
Bioaccumulative potential: No data available.
Mobility in soil: No data available.
Other adverse effects: No data available.

13.Disposal considerations

Waste from residues: Dispose of as laboratory chemical waste through a licensed waste disposal contractor in accordance with local, state and federal regulations. Do not discharge to drains.
Contaminated packaging: Dispose of as unused product. Rinsed glass vials may be recycled where local rules allow.

14.Transport information

UN number: Not assigned
UN proper shipping name: Not regulated as a dangerous good
Transport hazard class: Not applicable (DOT, IATA, IMDG)
Packing group: Not applicable
Environmental hazards: Not classified as a marine pollutant
Special precautions: Ship cold-packed; the lyophilised powder tolerates short periods at ambient temperature.

15.Regulatory information

United States (FDA): This substance is not approved by the US Food and Drug Administration as a drug, food, dietary supplement or cosmetic. It is supplied for in-vitro laboratory research only and is not for human or veterinary use.
OSHA Hazard Communication Standard (29 CFR 1910.1200): Not classified as hazardous on the basis of available data.
TSCA (US): Not evaluated. Supplied in research quantities only.
SARA 302 / 313, California Proposition 65: Not listed.
Other: Purchaser must be 21 years of age or older and a qualified researcher. The product may not be used in or on humans or animals.

16.Other information

Revision date: 2026-11-04
Version: 1.0
Prepared by: Licensed Peptides, Inc. (regulatory and quality documentation)
Data sources: PubChem CID 71587328 (formula, average and monoisotopic mass, InChIKey NZWIFMYRRCMYMN-ACMTZBLWSA-M); lot Certificate of Analysis for purity and content; GHS Revision 9 for section structure.
Disclaimer: The information in this safety data sheet is believed to be accurate as of the revision date and is provided for guidance on safe handling, storage and disposal in a laboratory setting. It is not a specification and does not constitute a warranty. The recipient is responsible for determining the suitability of the substance for the intended research application and for compliance with all applicable regulations.

Download SDS (PDF), BPC-157BPC-157, CAS 137525-51-0

1.Identification

Product identifier: BPC-157
CAS number: 137525-51-0
Product form: Lyophilised peptide, supplied by Licensed Peptides in sealed research packaging; the format of each product (vial, blend component, encapsulated research formulation or atomized solution) is stated on its product page.
Recommended use: Laboratory research reagent for in-vitro use by qualified researchers
Restrictions on use: Not for human or veterinary use. Not a drug, food, cosmetic or household product.
Supplier: Licensed Peptides, Inc., 1489 W Palmetto Park Rd, Boca Raton, FL 33486, USA
Supplier contact: service@licensedpeptides.com, +1 (855) 322-2214 (Mon to Fri, 8:30 AM to 6:30 PM ET)
Emergency telephone: +1 (855) 322-2214 (Mon to Fri, 8:30 AM to 6:30 PM ET). For a medical emergency contact local emergency services or a poison control centre.

2.Hazard identification

GHS classification: Not classified under GHS (Rev. 9) on the basis of the data available for this substance.
Signal word: None
Hazard statements: None assigned
Precautionary statements: None assigned. Handle as a laboratory chemical of unknown toxicity: avoid dust formation, avoid contact with eyes, skin and clothing, do not swallow.
Other hazards: Fine lyophilised powder may form dust. No data available on other hazards.

3.Composition / information on ingredients

Substance / mixture: Substance (synthetic peptide), may contain counter-ion and residual water from lyophilisation
Chemical name: H-Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val-OH
Sequence (one-letter): GEPPPGKPADDAGLV
Sequence (three-letter): H-Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val-OH
CAS number: 137525-51-0
Molecular formula: C62H98N16O22
Concentration: Content as stated on the lot Certificate of Analysis (see /lab-reports/).
Impurities contributing to classification: None known

4.First-aid measures

General advice: Show this safety data sheet to the attending physician. Remove contaminated clothing.
If inhaled: Move the person to fresh air. If breathing is difficult, obtain medical attention.
In case of skin contact: Wash with plenty of soap and water. Obtain medical attention if irritation develops or persists.
In case of eye contact: Rinse cautiously with water for several minutes. Remove contact lenses if present and easy to do. Continue rinsing. Obtain medical attention if irritation persists.
If swallowed: Rinse mouth with water. Do not induce vomiting. Obtain medical attention.
Most important effects, acute and delayed: No data available.
Indication of immediate medical attention: No data available. Care at the discretion of the attending physician.

5.Fire-fighting measures

Suitable extinguishing media: Water spray, dry chemical, carbon dioxide or alcohol-resistant foam, chosen for the surrounding fire.
Unsuitable extinguishing media: None known.
Specific hazards: Organic powder; combustion may release carbon oxides and nitrogen oxides.
Advice for fire-fighters: Wear self-contained breathing apparatus and full fire-fighting gear.

6.Accidental release measures

Personal precautions: Avoid dust formation. Wear gloves, eye protection and a laboratory coat. Ensure adequate ventilation.
Environmental precautions: Do not let the substance enter drains. Quantities supplied are milligram scale.
Containment and clean-up: Sweep up or wipe with a damp cloth without creating dust, place in a closed container for disposal, then clean the area with water.

7.Handling and storage

Precautions for safe handling: Handle in a laboratory setting by trained personnel. Avoid dust formation and contact with skin and eyes. Wash hands after handling. Keep the vial closed when not in use.
Conditions for safe storage: Store lyophilised at -20 °C in the original sealed vial, desiccated and protected from light. Keep away from strong oxidising agents. Short periods at ambient temperature during shipping are tolerated by the lyophilised powder.
Specific end use: Laboratory research reagent only.

8.Exposure controls / personal protection

Occupational exposure limits: None established for this substance.
Engineering controls: Handle the powder in a fume hood or ventilated enclosure. Eyewash station and safety shower should be available.
Eye / face protection: Safety glasses with side shields or chemical goggles (EN 166 or ANSI Z87.1).
Skin protection: Nitrile gloves inspected before use; laboratory coat.
Respiratory protection: Not normally required when handled in a fume hood. For dust-forming operations outside a hood use a particulate respirator (N95 or P2 type).
Hygiene measures: Do not eat, drink or smoke in the laboratory. Wash hands after handling.

9.Physical and chemical properties

Appearance: White to off-white lyophilised powder
Odour: Odourless
Molecular formula: C62H98N16O22
Molecular weight (average): 1419.5 g/mol
Monoisotopic mass: 1418.704 Da
Solubility: Soluble in water (supplier specification). Quantitative solubility: no data available.
pH, melting point, boiling point, flash point, vapour pressure, density, partition coefficient, auto-ignition temperature, decomposition temperature, viscosity: No data available
Flammability: No data available (organic powder, not expected to be readily flammable)

10.Stability and reactivity

Reactivity: No data available.
Chemical stability: Stable under the recommended storage conditions (lyophilised, -20 °C, desiccated, protected from light).
Possibility of hazardous reactions: None known.
Conditions to avoid: Moisture, prolonged exposure to light and elevated temperature; repeated freeze-thaw of solutions.
Incompatible materials: Strong oxidising agents, strong acids and bases.
Hazardous decomposition products: None known under normal storage. Combustion: carbon oxides and nitrogen oxides.

11.Toxicological information

Acute toxicity: No data available for this substance (all exposure routes).
Skin corrosion / irritation: No data available.
Serious eye damage / irritation: No data available.
Respiratory or skin sensitisation: No data available.
Germ cell mutagenicity: No data available.
Carcinogenicity: No data available. Not listed by IARC, NTP or OSHA.
Reproductive toxicity: No data available.
Specific target organ toxicity (single and repeated exposure): No data available.
Aspiration hazard: No data available.
Additional information: This safety data sheet does not describe biological activity. The substance has not been evaluated for any use other than in-vitro laboratory research.

12.Ecological information

Ecotoxicity: No data available.
Persistence and degradability: No data available. As a peptide it is expected to be hydrolysed by environmental proteases.
Bioaccumulative potential: No data available.
Mobility in soil: No data available.
Other adverse effects: No data available.

13.Disposal considerations

Waste from residues: Dispose of as laboratory chemical waste through a licensed waste disposal contractor in accordance with local, state and federal regulations. Do not discharge to drains.
Contaminated packaging: Dispose of as unused product. Rinsed glass vials may be recycled where local rules allow.

14.Transport information

UN number: Not assigned
UN proper shipping name: Not regulated as a dangerous good
Transport hazard class: Not applicable (DOT, IATA, IMDG)
Packing group: Not applicable
Environmental hazards: Not classified as a marine pollutant
Special precautions: Ship cold-packed; the lyophilised powder tolerates short periods at ambient temperature.

15.Regulatory information

United States (FDA): This substance is not approved by the US Food and Drug Administration as a drug, food, dietary supplement or cosmetic. It is supplied for in-vitro laboratory research only and is not for human or veterinary use.
OSHA Hazard Communication Standard (29 CFR 1910.1200): Not classified as hazardous on the basis of available data.
TSCA (US): Not evaluated. Supplied in research quantities only.
SARA 302 / 313, California Proposition 65: Not listed.
Other: Purchaser must be 21 years of age or older and a qualified researcher. The product may not be used in or on humans or animals.

16.Other information

Revision date: 2026-11-04
Version: 1.0
Prepared by: Licensed Peptides, Inc. (regulatory and quality documentation)
Data sources: PubChem CID 9941957 (formula, average and monoisotopic mass, InChIKey HEEWEZGQMLZMFE-RKGINYAYSA-N); lot Certificate of Analysis for purity and content; GHS Revision 9 for section structure.
Disclaimer: The information in this safety data sheet is believed to be accurate as of the revision date and is provided for guidance on safe handling, storage and disposal in a laboratory setting. It is not a specification and does not constitute a warranty. The recipient is responsible for determining the suitability of the substance for the intended research application and for compliance with all applicable regulations.

Download SDS (PDF), TB-500TB-500 (thymosin beta-4), CAS 77591-33-4

1.Identification

Product identifier: TB-500 (thymosin beta-4)
CAS number: 77591-33-4
Product form: Lyophilised peptide, supplied by Licensed Peptides in sealed research packaging; the format of each product (vial, blend component, encapsulated research formulation or atomized solution) is stated on its product page.
Recommended use: Laboratory research reagent for in-vitro use by qualified researchers
Restrictions on use: Not for human or veterinary use. Not a drug, food, cosmetic or household product.
Supplier: Licensed Peptides, Inc., 1489 W Palmetto Park Rd, Boca Raton, FL 33486, USA
Supplier contact: service@licensedpeptides.com, +1 (855) 322-2214 (Mon to Fri, 8:30 AM to 6:30 PM ET)
Emergency telephone: +1 (855) 322-2214 (Mon to Fri, 8:30 AM to 6:30 PM ET). For a medical emergency contact local emergency services or a poison control centre.

2.Hazard identification

GHS classification: Not classified under GHS (Rev. 9) on the basis of the data available for this substance.
Signal word: None
Hazard statements: None assigned
Precautionary statements: None assigned. Handle as a laboratory chemical of unknown toxicity: avoid dust formation, avoid contact with eyes, skin and clothing, do not swallow.
Other hazards: Fine lyophilised powder may form dust. No data available on other hazards.

3.Composition / information on ingredients

Substance / mixture: Substance (synthetic peptide), may contain counter-ion and residual water from lyophilisation
Chemical name: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH
Sequence (one-letter): SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Sequence (three-letter): Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH
CAS number: 77591-33-4
Molecular formula: C212H350N56O78S
Concentration: Content as stated on the lot Certificate of Analysis (see /lab-reports/).
Impurities contributing to classification: None known

4.First-aid measures

General advice: Show this safety data sheet to the attending physician. Remove contaminated clothing.
If inhaled: Move the person to fresh air. If breathing is difficult, obtain medical attention.
In case of skin contact: Wash with plenty of soap and water. Obtain medical attention if irritation develops or persists.
In case of eye contact: Rinse cautiously with water for several minutes. Remove contact lenses if present and easy to do. Continue rinsing. Obtain medical attention if irritation persists.
If swallowed: Rinse mouth with water. Do not induce vomiting. Obtain medical attention.
Most important effects, acute and delayed: No data available.
Indication of immediate medical attention: No data available. Care at the discretion of the attending physician.

5.Fire-fighting measures

Suitable extinguishing media: Water spray, dry chemical, carbon dioxide or alcohol-resistant foam, chosen for the surrounding fire.
Unsuitable extinguishing media: None known.
Specific hazards: Organic powder; combustion may release carbon oxides, nitrogen oxides and sulfur oxides.
Advice for fire-fighters: Wear self-contained breathing apparatus and full fire-fighting gear.

6.Accidental release measures

Personal precautions: Avoid dust formation. Wear gloves, eye protection and a laboratory coat. Ensure adequate ventilation.
Environmental precautions: Do not let the substance enter drains. Quantities supplied are milligram scale.
Containment and clean-up: Sweep up or wipe with a damp cloth without creating dust, place in a closed container for disposal, then clean the area with water.

7.Handling and storage

Precautions for safe handling: Handle in a laboratory setting by trained personnel. Avoid dust formation and contact with skin and eyes. Wash hands after handling. Keep the vial closed when not in use.
Conditions for safe storage: Store lyophilised at -20 °C in the original sealed vial, desiccated and protected from light. Keep away from strong oxidising agents. Short periods at ambient temperature during shipping are tolerated by the lyophilised powder.
Specific end use: Laboratory research reagent only.

8.Exposure controls / personal protection

Occupational exposure limits: None established for this substance.
Engineering controls: Handle the powder in a fume hood or ventilated enclosure. Eyewash station and safety shower should be available.
Eye / face protection: Safety glasses with side shields or chemical goggles (EN 166 or ANSI Z87.1).
Skin protection: Nitrile gloves inspected before use; laboratory coat.
Respiratory protection: Not normally required when handled in a fume hood. For dust-forming operations outside a hood use a particulate respirator (N95 or P2 type).
Hygiene measures: Do not eat, drink or smoke in the laboratory. Wash hands after handling.

9.Physical and chemical properties

Appearance: White to off-white lyophilised powder
Odour: Odourless
Molecular formula: C212H350N56O78S
Molecular weight (average): 4963.5 g/mol
Monoisotopic mass: 4960.486 Da
Solubility: Soluble in water (supplier specification). Quantitative solubility: no data available.
pH, melting point, boiling point, flash point, vapour pressure, density, partition coefficient, auto-ignition temperature, decomposition temperature, viscosity: No data available
Flammability: No data available (organic powder, not expected to be readily flammable)

10.Stability and reactivity

Reactivity: No data available.
Chemical stability: Stable under the recommended storage conditions (lyophilised, -20 °C, desiccated, protected from light).
Possibility of hazardous reactions: None known.
Conditions to avoid: Moisture, prolonged exposure to light and elevated temperature; repeated freeze-thaw of solutions.
Incompatible materials: Strong oxidising agents, strong acids and bases.
Hazardous decomposition products: None known under normal storage. Combustion: carbon oxides and nitrogen oxides.

11.Toxicological information

Acute toxicity: No data available for this substance (all exposure routes).
Skin corrosion / irritation: No data available.
Serious eye damage / irritation: No data available.
Respiratory or skin sensitisation: No data available.
Germ cell mutagenicity: No data available.
Carcinogenicity: No data available. Not listed by IARC, NTP or OSHA.
Reproductive toxicity: No data available.
Specific target organ toxicity (single and repeated exposure): No data available.
Aspiration hazard: No data available.
Additional information: This safety data sheet does not describe biological activity. The substance has not been evaluated for any use other than in-vitro laboratory research.

12.Ecological information

Ecotoxicity: No data available.
Persistence and degradability: No data available. As a peptide it is expected to be hydrolysed by environmental proteases.
Bioaccumulative potential: No data available.
Mobility in soil: No data available.
Other adverse effects: No data available.

13.Disposal considerations

Waste from residues: Dispose of as laboratory chemical waste through a licensed waste disposal contractor in accordance with local, state and federal regulations. Do not discharge to drains.
Contaminated packaging: Dispose of as unused product. Rinsed glass vials may be recycled where local rules allow.

14.Transport information

UN number: Not assigned
UN proper shipping name: Not regulated as a dangerous good
Transport hazard class: Not applicable (DOT, IATA, IMDG)
Packing group: Not applicable
Environmental hazards: Not classified as a marine pollutant
Special precautions: Ship cold-packed; the lyophilised powder tolerates short periods at ambient temperature.

15.Regulatory information

United States (FDA): This substance is not approved by the US Food and Drug Administration as a drug, food, dietary supplement or cosmetic. It is supplied for in-vitro laboratory research only and is not for human or veterinary use.
OSHA Hazard Communication Standard (29 CFR 1910.1200): Not classified as hazardous on the basis of available data.
TSCA (US): Not evaluated. Supplied in research quantities only.
SARA 302 / 313, California Proposition 65: Not listed.
Other: Purchaser must be 21 years of age or older and a qualified researcher. The product may not be used in or on humans or animals.

16.Other information

Revision date: 2026-11-04
Version: 1.0
Prepared by: Licensed Peptides, Inc. (regulatory and quality documentation)
Data sources: PubChem CID 45382195 (formula, average and monoisotopic mass, InChIKey UGPMCIBIHRSCBV-UHFFFAOYSA-N); UniProt P62328 for the sequence; lot Certificate of Analysis for purity and content; GHS Revision 9 for section structure.
Disclaimer: The information in this safety data sheet is believed to be accurate as of the revision date and is provided for guidance on safe handling, storage and disposal in a laboratory setting. It is not a specification and does not constitute a warranty. The recipient is responsible for determining the suitability of the substance for the intended research application and for compliance with all applicable regulations.

Download SDS (PDF), KPVKPV, CAS 67727-97-3

1.Identification

Product identifier: KPV
CAS number: 67727-97-3
Product form: Lyophilised peptide, supplied by Licensed Peptides in sealed research packaging; the format of each product (vial, blend component, encapsulated research formulation or atomized solution) is stated on its product page.
Recommended use: Laboratory research reagent for in-vitro use by qualified researchers
Restrictions on use: Not for human or veterinary use. Not a drug, food, cosmetic or household product.
Supplier: Licensed Peptides, Inc., 1489 W Palmetto Park Rd, Boca Raton, FL 33486, USA
Supplier contact: service@licensedpeptides.com, +1 (855) 322-2214 (Mon to Fri, 8:30 AM to 6:30 PM ET)
Emergency telephone: +1 (855) 322-2214 (Mon to Fri, 8:30 AM to 6:30 PM ET). For a medical emergency contact local emergency services or a poison control centre.

2.Hazard identification

GHS classification: Not classified under GHS (Rev. 9) on the basis of the data available for this substance.
Signal word: None
Hazard statements: None assigned
Precautionary statements: None assigned. Handle as a laboratory chemical of unknown toxicity: avoid dust formation, avoid contact with eyes, skin and clothing, do not swallow.
Other hazards: Fine lyophilised powder may form dust. No data available on other hazards.

3.Composition / information on ingredients

Substance / mixture: Substance (synthetic peptide), may contain counter-ion and residual water from lyophilisation
Chemical name: H-Lys-Pro-Val-OH
Sequence (one-letter): KPV
Sequence (three-letter): H-Lys-Pro-Val-OH
CAS number: 67727-97-3
Molecular formula: C16H30N4O4
Concentration: Content as stated on the lot Certificate of Analysis (see /lab-reports/).
Impurities contributing to classification: None known

4.First-aid measures

General advice: Show this safety data sheet to the attending physician. Remove contaminated clothing.
If inhaled: Move the person to fresh air. If breathing is difficult, obtain medical attention.
In case of skin contact: Wash with plenty of soap and water. Obtain medical attention if irritation develops or persists.
In case of eye contact: Rinse cautiously with water for several minutes. Remove contact lenses if present and easy to do. Continue rinsing. Obtain medical attention if irritation persists.
If swallowed: Rinse mouth with water. Do not induce vomiting. Obtain medical attention.
Most important effects, acute and delayed: No data available.
Indication of immediate medical attention: No data available. Care at the discretion of the attending physician.

5.Fire-fighting measures

Suitable extinguishing media: Water spray, dry chemical, carbon dioxide or alcohol-resistant foam, chosen for the surrounding fire.
Unsuitable extinguishing media: None known.
Specific hazards: Organic powder; combustion may release carbon oxides and nitrogen oxides.
Advice for fire-fighters: Wear self-contained breathing apparatus and full fire-fighting gear.

6.Accidental release measures

Personal precautions: Avoid dust formation. Wear gloves, eye protection and a laboratory coat. Ensure adequate ventilation.
Environmental precautions: Do not let the substance enter drains. Quantities supplied are milligram scale.
Containment and clean-up: Sweep up or wipe with a damp cloth without creating dust, place in a closed container for disposal, then clean the area with water.

7.Handling and storage

Precautions for safe handling: Handle in a laboratory setting by trained personnel. Avoid dust formation and contact with skin and eyes. Wash hands after handling. Keep the vial closed when not in use.
Conditions for safe storage: Store lyophilised at -20 °C in the original sealed vial, desiccated and protected from light. Keep away from strong oxidising agents. Short periods at ambient temperature during shipping are tolerated by the lyophilised powder.
Specific end use: Laboratory research reagent only.

8.Exposure controls / personal protection

Occupational exposure limits: None established for this substance.
Engineering controls: Handle the powder in a fume hood or ventilated enclosure. Eyewash station and safety shower should be available.
Eye / face protection: Safety glasses with side shields or chemical goggles (EN 166 or ANSI Z87.1).
Skin protection: Nitrile gloves inspected before use; laboratory coat.
Respiratory protection: Not normally required when handled in a fume hood. For dust-forming operations outside a hood use a particulate respirator (N95 or P2 type).
Hygiene measures: Do not eat, drink or smoke in the laboratory. Wash hands after handling.

9.Physical and chemical properties

Appearance: White to off-white lyophilised powder
Odour: Odourless
Molecular formula: C16H30N4O4
Molecular weight (average): 342.43 g/mol
Monoisotopic mass: 342.227 Da
Solubility: Soluble in water (supplier specification). Quantitative solubility: no data available.
pH, melting point, boiling point, flash point, vapour pressure, density, partition coefficient, auto-ignition temperature, decomposition temperature, viscosity: No data available
Flammability: No data available (organic powder, not expected to be readily flammable)

10.Stability and reactivity

Reactivity: No data available.
Chemical stability: Stable under the recommended storage conditions (lyophilised, -20 °C, desiccated, protected from light).
Possibility of hazardous reactions: None known.
Conditions to avoid: Moisture, prolonged exposure to light and elevated temperature; repeated freeze-thaw of solutions.
Incompatible materials: Strong oxidising agents, strong acids and bases.
Hazardous decomposition products: None known under normal storage. Combustion: carbon oxides and nitrogen oxides.

11.Toxicological information

Acute toxicity: No data available for this substance (all exposure routes).
Skin corrosion / irritation: No data available.
Serious eye damage / irritation: No data available.
Respiratory or skin sensitisation: No data available.
Germ cell mutagenicity: No data available.
Carcinogenicity: No data available. Not listed by IARC, NTP or OSHA.
Reproductive toxicity: No data available.
Specific target organ toxicity (single and repeated exposure): No data available.
Aspiration hazard: No data available.
Additional information: This safety data sheet does not describe biological activity. The substance has not been evaluated for any use other than in-vitro laboratory research.

12.Ecological information

Ecotoxicity: No data available.
Persistence and degradability: No data available. As a peptide it is expected to be hydrolysed by environmental proteases.
Bioaccumulative potential: No data available.
Mobility in soil: No data available.
Other adverse effects: No data available.

13.Disposal considerations

Waste from residues: Dispose of as laboratory chemical waste through a licensed waste disposal contractor in accordance with local, state and federal regulations. Do not discharge to drains.
Contaminated packaging: Dispose of as unused product. Rinsed glass vials may be recycled where local rules allow.

14.Transport information

UN number: Not assigned
UN proper shipping name: Not regulated as a dangerous good
Transport hazard class: Not applicable (DOT, IATA, IMDG)
Packing group: Not applicable
Environmental hazards: Not classified as a marine pollutant
Special precautions: Ship cold-packed; the lyophilised powder tolerates short periods at ambient temperature.

15.Regulatory information

United States (FDA): This substance is not approved by the US Food and Drug Administration as a drug, food, dietary supplement or cosmetic. It is supplied for in-vitro laboratory research only and is not for human or veterinary use.
OSHA Hazard Communication Standard (29 CFR 1910.1200): Not classified as hazardous on the basis of available data.
TSCA (US): Not evaluated. Supplied in research quantities only.
SARA 302 / 313, California Proposition 65: Not listed.
Other: Purchaser must be 21 years of age or older and a qualified researcher. The product may not be used in or on humans or animals.

16.Other information

Revision date: 2026-11-04
Version: 1.0
Prepared by: Licensed Peptides, Inc. (regulatory and quality documentation)
Data sources: PubChem CID 125672 (formula, average and monoisotopic mass, InChIKey YSPZCHGIWAQVKQ-AVGNSLFASA-N); lot Certificate of Analysis for purity and content; GHS Revision 9 for section structure.
Disclaimer: The information in this safety data sheet is believed to be accurate as of the revision date and is provided for guidance on safe handling, storage and disposal in a laboratory setting. It is not a specification and does not constitute a warranty. The recipient is responsible for determining the suitability of the substance for the intended research application and for compliance with all applicable regulations.

Intended use. This product is not a drug, food, dietary supplement or cosmetic. It is supplied as a lyophilised laboratory reagent for in-vitro research by qualified researchers only and is not for human or veterinary use. The statements on this page have not been evaluated by the US Food and Drug Administration, and the product is not intended to diagnose, treat, cure or prevent any disease. Purchasers must be 21 years of age or older. Licensed Peptides is a chemical supplier, not a pharmacy.

99%+ Purity

Guaranteed per batch

HPLC + LAL

Independent lab verified

Endotoxin-Free

Vanguard Laboratory · ISO/IEC 17025

GMP-Certified

USA-manufactured

Same-Day Shipping

Free FedEx on $200+

Vendor Comparison

Why Researchers Choose Licensed Peptides

Not all peptide vendors hold themselves to the same verification standards.

Verification Standard	Licensed Peptides	Generic Vendors
HPLC Purity Analysis	99%+ Every Batch	Often Not Disclosed
Endotoxin Screening (LAL)	Every Product	Industry Exception
GMP-Certified USA Manufacture	ISO 9001:2015	Often Overseas
COA Published & Downloadable	Every Lot	Inconsistent
Same-Day USA Fulfillment	Before 4PM PST	3-10 Day Lead Time

Research Questions

Frequently Asked Questions

The Klow Blend is intended exclusively for laboratory research, experimental modeling, and scientific investigation. It is not approved for human or animal use.

Combining peptides allows researchers to examine how multiple pathway responses compare or interact under controlled laboratory conditions.

This blend is typically used in in-vitro, ex-vivo, and analytical laboratory environments, including cellular signaling studies and tissue-model research.

KPV contributes a focused inflammatory-signaling research angle that can be studied alongside the other peptides in the blend.

TB-500 refers to the complete 43-amino-acid sequence of Thymosin Beta-4 used in research literature.

GHK-Cu provides a gene-expression and extracellular-matrix research angle that can be explored in controlled laboratory studies.

Yes. Researchers may examine inflammatory markers and cytokine-related pathways in controlled experimental models.

Published research context may discuss each peptide individually or in combination, but such references are provided only for scientific context.

It may be relevant for studies examining cellular aging, structural protein turnover, and oxidative signaling pathways under controlled conditions.

Most stacks focus on one or two biological targets. The Klow Blend offers a fourcomponent, multi-pathway research system.

No. This product is not a drug, supplement, or therapy and is not regulated for medical, human, or veterinary application.

No. Licensed Peptides supplies peptides strictly for research purposes and does not provide consumption or administration instructions.

LPS-free indicates that each peptide in the KLOW Blend is manufactured without detectable lipopolysaccharide contamination, which can help reduce interference in
sensitive laboratory studies.

Endotoxins can alter cellular responses and skew experimental data. Endotoxin-free materials help researchers interpret laboratory results with fewer contamination-related variables.

Yes. The peptides are endotoxin tested to support analytical consistency in laboratory and in vitro research.

Frequently Paired With

Researchers Also Order

Not all peptide vendors hold themselves to the same verification standards.

Popular Peptides

TB-500 (Thymosin Beta-4) 10mg

CAS: 77591-33-4

$99.99

View Product

Bulk Offer